modENCODE |  Help |  blog

Antibody : insv

Host Organism  Rabbit Antigen  MENQYQRIVSATAREDSQARRSKPLFLNAWSQTSSVDFEVLRSISAPDPQ VEVENRALRDKVRYLEAKLQQHKDLLSQIHATSARMQQASSLLAESRPPT PPAVQSHHILTPPSSEICAPAQNPQILDYKIISAPDDADAIEIRLAAESL NSLSTSADSDRLEICLGDENHQQSNHHNSQQQYRISNGIKRDGSSESADT PLQFIKRRKLQEIQLQEEIPRQNIKLPAKPQVKARNGSFTDLNKGQQQNM DNVMVSIGPNNTCVPASVFENINWSVCSLATRKLLVTIFDRETLATHSMT GKPSPAFKDQDKPLKRMLDPGKIQDIIFAVTHKCNASEKEVRNAITTKCA DENKMMKIQNVKRRSSGIKHEKENII
Target Name  INSV Type  antibody

Mod Mine Wiki Displayer