modENCODE |  Help |  blog

Antibody : anti-Fru

Host Organism  Rabbit Antigen  YSQYLGWNYGAWRPDDPNPKQQQQQPHRKAQPFNFYARDYYYQQHQQQQQQQQSPISSMSNGNMRQQQQQQQQHRRQQQLPPAQTIIIDESDNELEEEQQMRLSFERYMEQLKQLAPYDPQETLCNSNTNNISNSNRNNNSNSNRSGEPTNANQMEATTTTTNSNNNNNNSYANHSTRNYNKRQQE
Target Name  fru Type  antibody

Mod Mine Wiki Displayer