modENCODE |  Help |  blog

Antibody : anti-CG16778

Host Organism  Rabbit Antigen  NLWRDWAAGAANANPMYFPAFELDQEMNPTPPSLPSRPALHQLACRELSFKPDLFMARRKLKRFRDKRQLQAQIETPTAAVPAPCPVSNALPPLRT
Target Name  CG16778 Type  antibody

Mod Mine Wiki Displayer