modENCODE |  Help |  blog

Antibody : bab-1

Host Organism  Rabbit Antigen  MASAQAETNVGLASEQGPVAQRQRKGTGSGADSPKSNRSSPTQQEEKRIK SEDRTSPTGGAKDEDKESQGHAVAGGGGSSPVSSPQGRSSSVASPSSSSQ QFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSP YFQTLLAETPCQHPIVIMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLR IAEMLKVRGLADVTHMEAATAAAAAASSERMPSSPKESTSTSRTEHDRER EAEELLAFMQPEKKLRTSDWDPAELRLSPLERQQGRNVRKRRWPSADTIF NPPAPPSPLSSLIAAERMELEQKERERQRDCSLMTPPPKPPMSSGSTVGA TRRLETAIHALDMPSPAATPGPLSRSSRPHSQSPQQQQAQQQGQLPLPLP LHPHHHASPAPHPSQTAGSAHHPASPAGDSRFPLGPAAAMAAARELSGLG PGPSAEPRLPPPPPHHHGGGGVGGGGVGGGGAGGVGSGGGSSLADDLEIK PGIAEMIREEERAKMMENSHAWMGATGSTLAADSYQYQLQSMWQKCWNTN QNLMHHMRFRERGPLKSWRPETMAEAIFSVLKEGLSLSQAARKYDIPYPT FVLYANRVHNMLGPSIDGGPDLRPKGRGRPQRILLGIWPDEHIKGVIKTV VFRDTKDIKDESLAAHMPPYGRHSPAFPLQDLPLSYPGASGALAGAPSSM ACPNGSGPQTGVGVAGEQHMSQETAAAVAAVAHNIRQQMQMAAVPPGLFN LPPHPGVGGGVGNVPGAAGGRASISPALSSGSGPRHAPSPCGPAGLLPNL PPSMAVALHHQQQQQAAHHHMQQLHLQQQQAHLHHHQQQQQQQQQQHHQG GHQVAHKSGFGASSSSSASSSSMGQHHAPKAKSSPLRSETPRLHSPLGDL GLDMASYKREFSPSRLFAEDLAELVGASVSSSSSSAAAATAPPERSAGAA SAATGADAPSSSSSGGIKVEPITTTSE
Target Name  bab-1 Type  antibody

Mod Mine Wiki Displayer