modENCODE |  Help |  blog

Antibody : KW0-CNC

Host Organism  Rabbit Antigen  LEEEHLTRDEKRARSLNIPISVPDIINLPMDEFNERLSKYDLSENQLSLIRDIRRRGKNKVAAQNCRKRKLDQILTLEDEVNAVVKRKTQLNQD
Target Name  cap'n collar Type  antibody

Mod Mine Wiki Displayer