modENCODE |  Help |  blog

Antibody : KW0:RUN-7659

Host Organism  Rabbit Antigen  VLLKLNTSIETSSIHEQSASDGDSDDEQIDVVKSEFDLDKSLDVAPLRMRCDLKAPSAMKPLYHESGPGAVANSRQPSPETTTKIKSAAVQQKTVWRPY
Target Name  RUNT Type  antibody

Mod Mine Wiki Displayer