modENCODE |  Help |  blog

Antibody : KW0:TTK-7691

Host Organism  Rabbit Antigen  FDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHPIVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTEVNDDK
Target Name  TRAMTRACK Type  antibody

Mod Mine Wiki Displayer