modENCODE |  Help |  blog

Antibody : UBX1

Host Organism  Rabbit Antigen  MNSYFEQASGFYGHPHQATGMAMGSGGHHDQTASAAAAAYRGFPLSLGMS PYANHHLQRTTQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGY KDIWNTGGSNGGGGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGG MPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQ SGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECP EDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQ TYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKL KKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGGHLDQ
Target Name  UBX Type  antibody

Mod Mine Wiki Displayer