modENCODE |  Help |  blog

Antibody : dCtBP-7667

Host Organism  Rabbit Antigen  VALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPG
Target Name  C-terminal Binding Protein Type  antibody

Mod Mine Wiki Displayer