modENCODE |  Help |  blog

Antibody : dll

Host Organism  Rabbit Antigen  MDAPDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRS TYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPP KDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLA LPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGG GPNPGQHSPNQMHSGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSELSPE FPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHHNPP PQMGGYVPQYWYQPETNPSLVT
Target Name  DLL Type  antibody

Mod Mine Wiki Displayer