modENCODE |  Help |  blog

Antibody : KW0:INV-7657

Host Organism  Rabbit Antigen  MSTLASTRPPPLKLTIPSLEEAEDHAQERRAGGGGQEVVKMHPDVLPLPLVQPGNSPQVREEEEDEQTECEEQLNIEDEEAEEEHDLDLEDPASCCSENSVLSV
Target Name  Invected Type  antibody

Mod Mine Wiki Displayer