modENCODE |  Help |  blog

Antibody : KW0:UBX-7701

Host Organism  Rabbit Antigen  MNSYFEQASGFYGHPHQATGMAMGSGGHHDQTASAAAAAYRGFPLSLGMSPYANHHLQRTTQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNT
Target Name  UBX Type  antibody

Mod Mine Wiki Displayer