modENCODE |  Help |  blog

Antibody : AD:brm

Host Organism  Rabbit Antigen  MASPSPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPG HPGAYGHPMQHGPPGQGPPGHHMPPHHQGMSPHMGMQMPPTGPNMSPYQT HGMPPNAPTQPCIVSPGGPPGGPPPPERSSQENLHALQRAIDSMEEKGLQ EDPRYSQLLAMRATSKHQHLNGNQVNLLRTQITAYRLLARNKPISMQMQQ ALQAAQQQPPPGPPIGPPGAPGGPPPGSQHAGQPPVPPQQQQQPPPSAGT PPQCSTPPASNPYGPPVPGQKMQVAPPPPHMQQGQPLPPQPPQVGGPPPI QQQQPPQQQQQQSQPPPPEPHQHQLPNGGKPLSMGPSGGQPLIPSSPMQP QVRGTLPGMPPGSQVPQPGGGPQRQVPPAGMPMPKPNRITTVAKPVGLDP ITLLQERENRIAARISLRMQELQRLPATMSEDLRLQAAIELRALRVLNFQ RQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLE AERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAER EQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISN LTQMVKQHKDDQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRV HVVEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKP KVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIA HTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGK TIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYK GSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHR MKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKS CSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVE HQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKAL MNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGVVSGPDLYRVSGKFELLD RILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRG ELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQA QDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQ KSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKR MDAERKKEDEEIHPGRERLIDESELPDWLTKDDDEVERFHYQYDEDTILG RGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRK EESDDDSLILKRRRRQNLDKRSKKQMHKIMSAVIKHNQDGRTLSEPFMKL PSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQI YNEEASLIYLDSIALQKVFVGARQRITAAADAAAVAAGDNTGEAHGNGGS DNSDNDDDDGGDDGSDDEEIATTSAAAVKMKLKLNKSLASAPATPTQSSS NVSSGAATTSKKQTRRKRSQKKYTISDDDDDDMD
Target Name  brahma Type  antibody

Mod Mine Wiki Displayer