modENCODE |  Help |  blog

Antibody : AD:snr1

Host Organism  Rabbit Antigen  MALQTYGDKPVAFQLEEGGEYYYVGSEVGNYMRHFRGILYKKYPGMTRIV LSNEERKRLAESGLSSHILASSVSLLRAVEVDDIMAGNDEKYRAVSVNTS DTPVPRESKSKKQPQYVPTMPNSSHLDAVPQATPINRNRVHTKKVRTFPM CFDDTDPTASLENAAQKECLVPIRLDMELEGQKLRDTFTWNKNESMITPE QFAEVLCDDLDLNPLPFVPAIAQAIRQQIEAFPNDPPILEETCDQRVIVK LNIHVGNTSLVDQVEWDMSEKNNNPEEFAIKLCAELGLGGEFVTAIAYSI RGQLSWHCRTYAFSEAPLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKI RDQDRNTRRMRRLANTTTGW
Target Name  SNR1 Type  antibody

Mod Mine Wiki Displayer