modENCODE |  Help |  blog

Antibody : KW0:GRO

Host Organism  Rabbit Antigen  IKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGQQIHA
Target Name  GROUCHO Type  antibody

Mod Mine Wiki Displayer