modENCODE |  Help |  blog

Antibody : KW3-Kr-D2

Host Organism  Rabbit Antigen  EASTNRFAAMCATYGGSNESVDMEKATPEDDGPLDLSEDGASSVDGHCSNIARRKAQDIRRVFRLPPPQIPHVPSDMPEQTEPEDLSMHSPRSIGSHEQT
Target Name  Kruppel Type  antibody

Mod Mine Wiki Displayer