modENCODE |  Help |  blog

Antibody : KW4-Hr39-D1

Host Organism  Rabbit Antigen  TDHLRRLRVDRYEYVAMKVIVLLQSDTTELQEAVKVRECQEKALQSLQAYTLAHYPDTPSKFGELLLRIPDLQRTCQLGKEMLTIKTRDGADFNLLMELLRGEH
Target Name  Hr39 Type  antibody

Mod Mine Wiki Displayer