modENCODE |  Help |  blog

Antibody : KNI-D2

Host Organism  Rabbit Antigen  QSPFQLPPHLLFPGYHASAAAAAASAADAAYRQEMYKHRQSVDSVESQNRFSPASQPPVVQPTSSARQSPIDVCLEE
Target Name  KNI Type  antibody

Mod Mine Wiki Displayer