modENCODE |  Help |  blog

Antibody : KW3-CG8478-D1

Host Organism  Rabbit Antigen  MKAQLPKIGGTSGINHPMTMPQKPQQRISTIPKLAPSQGTQSMAPPSVKKIPKNVAHAGVYRTPTKTVPCHICKQSFRSILEFTNHSLTVHGNNQLKKMTGREDAQSAHDC
Target Name  CG8478 Type  antibody

Mod Mine Wiki Displayer