modENCODE |  Help |  blog

Antibody : KW4-PCL-D2

Host Organism  Rabbit Antigen  MPKRVPKDVYEFNTDEDDPVETSEDEIPIKQIIEKAKKQAAQKADKHDELPLKPDLADDNANDGDPGKLPAPIPPLLDANSSRKRKAFRLSKRYDNSRNHCDLSSDENC
Target Name  PCL Type  antibody

Mod Mine Wiki Displayer