modENCODE |  Help |  blog

Antibody : Sin3A-RC

Host Organism  Rabbit Antigen  MMKRTRVDEVQFGTRPVPQTSGGVGVGVVGVTGGGPTSGGGGTATVGVNT TGVTIGTVVPSAHNATISGIGSIHHRILTPQHGGAQTIAYLPSTTPTATN LKTTTSIVDSTTAGGPVGAGAQVAVGVGSAAGGGGVVVSTGSTGTQTLQY TTSYSVASIQAGGTLKANTADGANTVQIHVTGGGAANNPASAQTVSSSSQ TGTIRQRTISGTQTVATAVGNLATISQQQPVQQSPLGKAQTPPSSVVANS IPVGGTTPPQGQSGNATPRLKVEDALSYLDQVKYQYADQPQIYNNFLDIM KEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPPGYKIEIHSDALGC SVPVVSMPSPPGAPTSTGTVHMLTGNSSMSGAGHIAIKTTNAATLTPAAG AGAAAAAAAVAQIQSAGAVNLMTHGGASLTQTTIHALQQATPPQSQSPGG GHVHVSVTNSTAANAVVPGQPGISVSAHNVPQNYSRDRERATITPTGQVA GAAANVNASASIVVGGPPTPNSLSELSPHGGAGGGPGAGAAQHNLHHIQQ AHQSILLGETGQQNQPVEFNHAITYVNKIKNRFQNQPAKYKKFLEILHDY QREQKVMKEGSLNQGKMLTEQEVYTQVAKLFGQDEDLLREFGQFLPDATN HQSGQYMSKSASVHNDHGKRPTATLSGGAHITMSSASPAPSGSPLHLGAT TLPQIDKSAHAAAIGNLSAVNTSVSIKTYNNNQQQQNHVIGSGLNATRND ILFEKDYHAGLQQQAHQRGAGVGGHHHLAGTAAGANIGRPGVGASVMVSY DKEHRNNHHVQKYVGHAPNQNLTHGHNAKKSPSYGIPSVIGSMPHISDNS LDRSSPGISYATPPLPSGPHGQHNSGSATRRPGDDSLVGHYASGAPPAKR PKPYCRDVSFSEASSKCTISDAAFFDKVRKALRSPEVYDNFLRCLTLFNQ EIVSKTELLGLVSPFLMKFPDLLRWFTDFLGPPSGQPAGGLIDGMPLAAT QRQGGGSSNSSHDRGTSHQSAAEYVQDVDLSSCKRLGASYCALPQSTVPK KCSGRTALCREVLNDKWVSFPTWASEDSTFVTSRKTQFEETIYRTEDERF ELDLVIEVNSATIRVLENLQKKMSRMSTEELSKFHLDDHLGGTSQTIHQR AIHRIYGDKSGEIITGMKKNPFVAVPIVLKRLKVKEEEWREAQKTFNKQW REQNEKYYLKSLDHQAINFKPNDMKALRSKSLFNEIETLYDERHDQEDDA MEPFGPHLVLPYKDKTILDDAANLLIHHVKRQTGIQKQEKQKIKQIIRQF VPDLFFAPRQPLSDDERDDAFPFLVDDNTKMDVDSPLGRTESSTRNAKST PSESASPARSNASTSSVTPAGIKKETDDSKATTGSFAPASSATASSATPV DDATPSTSSAAAAASAASSSTVSGTEGKPKDDPLSSHKEEGAGSTSSGVA TSPRQAQDTAGAGVDVEIKLEHPADFSNPKLLPPHAHGQREDESYTLFFA NNNWYLFLRLHAILCDRLHVMYERARLLAIEEERCRVNRRESTATALRLK PKPEIQVEDYYPTFLDMLKNVLDGNMDSNTFEDTMREMFGIYAYISFTLD KVVSNAVRQLQYCVTERAALDCVELFATEQRRGCTGGFCRDAHKTFDREM SYQRKAESILNEENCFKVYIYKIDCRVTIELLDSEPEEVDKPAALKAQKF SKYVERLANPALGGGGNTGRSDSALGNDSVVDGSDIKTEADEDTAELRYR EGGIGGAGKARFLVRNKRRSKLLEEQVRQLFEHRRNRIEQHGTAASLEPI SVDSAISSNSTTGGGGSGTNNNNNNNNNNNSWGGKRLERLGAPQVGLAEQ YAFNDRDEISTNISNGRCFVTSKNLKLLKYDAVRRAKKSHCRVTQAKYAH FQTYVNKWLQQHVSEQQQQNCVDWLLGKTADQINASGWGSASKTKTVQQK DTSKTPYRIYNRYRVVQSAVSGGLMSATAPTPDGSVPAVNSAPSGSVSTV NNVQGSAAVSSTSHSMCNSSILSADSTTNTNASAQQQQHCNSAAAATTPN AEALQQVRPMES
Target Name  Sin3A Type  antibody

Mod Mine Wiki Displayer