modENCODE |  Help |  blog

Antibody : KW4-mod(mdg4)-D2

Host Organism  Rabbit Antigen  MPRASARYKIETVDDGLGDEKQSTTQIVIQTTAAPQATIVQQQQPQQAAQQIQSQQLQTGTTTTATLVSTNKRSAQRSSLTPASSSAGVKRSKTSTSANVMDPLDSTTETGC
Target Name  mod(mdg4) Type  antibody

Mod Mine Wiki Displayer