modENCODE |  Help |  blog

Antibody : KW4-E(z)-D2

Host Organism  Rabbit Antigen  MCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIVC
Target Name  Enhancer of zeste Type  antibody

Mod Mine Wiki Displayer