modENCODE |  Help |  blog

Antibody : sens

Host Organism  Guinea Pig Antigen  MNHLSPPPSPHSQQPSPAGLGCHGAALDKQWMQRASAFNTVIASAAAQKL NGRDLPFLYNPLLYSSALLWPQFLLSSATALGTPLTPMTPKSPASVVLGQ RDRDFALTPEKEHELQMNNNNENSKQDYQEQDEDMPLNLSTKERITSDDS NRDQYHSSSNNSSRSSSSSEVEQLHPMTSLNVTPPPLSAVNLKSSSTPQQ QRQRSQGNIIWSPASMCERSARREQYGLKMEEQGDEEEHQVDPIVRKFKY ERRTASISSLQSPISSLSAPASNAVQDLEFEVAQQQLYAHRSAFMAGLTG NNLELLTQHLKLKSEQPQQQQQQHRIKDEQQQDNRSAAALMNLVAAAEFG YMRNQHQQPQQQQQQQLHHQQQPQQHQHQQQHPDSTATDVARRSSSSSSY QGENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRF HQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCH LCDQSFQRKVDLRRHRESRHEEAPPVEDLKPLKMEVSSSSC
Target Name  senseless Type  antibody

Mod Mine Wiki Displayer