modENCODE |  Help |  blog
modMine: Error page
modENCODE |  Help |  blog

There has been an internal error while processing your request. The problem has been logged and will be investigated. You may also send us an email describing how you encountered this error.

The problem may be temporary in which case you might wish to go back and try your request again or you might want to go to the home page.





Antibody : KW3-hkb-D1

Host Organism  Rabbit Antigen  MDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGPSIFVPMYSYLYG
Target Name  Huckebein Type  antibody

Mod Mine Wiki Displayer