modENCODE |  Help |  blog

Antibody : KW3-hkb-D1

Host Organism  Rabbit Antigen  MDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGPSIFVPMYSYLYG
Target Name  Huckebein Type  antibody

Mod Mine Wiki Displayer