modENCODE |  Help |  blog

Antibody : KW3-h-D1

Host Organism  Rabbit Antigen  PMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRP
Target Name  Hairy Type  antibody

Mod Mine Wiki Displayer