modENCODE |  Help |  blog

Antibody : bks

Host Organism  Mouse Antigen  HIAAQLAAAAASNSYSGSGANTNQGQNS NAGGNGGSESKAAAAAQAKLMAPGMISATMHHTISVPAGTGTGDDDTKSP PAKRVKHEAGASGAGGGKEMVDICIGTSVGTITEPDCLGPCEPGTSVTLE GIVWHETEGGVLVVNVTWRGKTYVGTLLDCTRHDWAPPRFCDSPTEELDS RTPKGRGKRGRSAGLTPDLSNFTETRSSIYFSHAQVHSKLRN
Target Name  Brakeless Type  antibody

Mod Mine Wiki Displayer