modENCODE |  Help |  blog

Antibody : BEAF-32

Host Organism  Rabbit Antigen  MHVEKKSELRSLLKSGDKRCKLVEPRNTKSCVWRFFNLVQCDDHIEPYAC
Target Name  BEAF-32 Type  antibody

Mod Mine Wiki Displayer