modENCODE |  Help |  blog

Antibody : LSD1_Q3430

Host Organism  Rabbit Antigen  aa 11-110 SKMTEPIEYVTLISDDSDGEPTPKRNVNHPPSALSAPNPGQKQKHPDEDSNDAPATSDERRTSRRNRPKVDYSNRPSGSGDTASNDKSGSASMGPNNQQA
Target Name  LSD1 Type  antibody

Mod Mine Wiki Displayer