modENCODE |  Help |  blog

Antibody : PR-Set7_Q3484

Host Organism  Rabbit Antigen  DQYFASPKRKDCRLMKVTQNGQLPEATMMAHNKDNKAGRTIGVPLATRSQTRTIENFFKANAAAKDSQKTIHTEEQLNLGNQELKLDDEELNGQIKLDDE
Target Name  PR-Set7 Type  antibody

Mod Mine Wiki Displayer